Donnerstag, 31. März 2016

Flüchtlinge und Finanzkrise: Bye, bye EU!

Tagungsort der 7. Mark-Banco-Anlegertagung:
das Maritime Museum in Hamburg.
Foto: CC0 Public Domain/Pixabay/ThomasJ
von Steffen Krug
„Zum leichtfertigen Spiel mit dem Geld und dem Geldwert gesellt sich also bei einer Währungsunion nach Maastricht-Muster der zwanghafte Teufelskreis eines politischen Abenteuers, an dessen Ende die Menschen des Alten Kontinents vor den Trümmern ihres jahrzehntelangen friedlichen und freundschaftlichen Zusammenwachsens stehen werden.“ Roland Baader, „Die Euro-Katastrophe“, 1993.

Die Bank für Internationalen Zahlungsausgleich in Basel ist die inoffizielle Zentralbank der Welt. In ihrem Quartalsbericht I/2016 gesteht sie erstmals ein, dass die Politikkombination aus hohen Schuldenständen und historisch niedrigen Zinssätzen die Finanzmärkte an die „Grenze des Undenkbaren“ gebracht hat. Einer der fragilsten Finanzmärkte ist dabei aufgrund ihrer wirtschaftlichen und politischen Heterogenität die Euro-Zone. Damit kommen hochbezahlte Zentralbankökonomen 23 Jahre nach dem Erscheinen von „Die Euro-Katastrophe“ zur gleichen Erkenntnis wie der Autor und Privatgelehrte Roland Baader, der bereits direkt nach Verabschiedung der EU-Verträge von Maastricht im Jahr 1993 den unvermeidlichen Niedergang des Finanzsystems und des friedlichen Miteinanders in der Euro-Zone prophezeite. 

Warum aber wurden die Argumente der Vertreter der Österreichischen Schule der Ökonomie und deren Geldreformvorschläge in den letzten Jahrzehnten im öffentlichen Diskurs schlichtweg ignoriert? Eine Studie des Hamburger Instituts für Journalistik ergab, dass die große Mehrheit der deutschen Journalisten mit rot-grüner Politik sympathisieren, sprich von den irrationalen und kollektivistischen Ideen der sogenannten Frankfurter Schule vereinnahmt sind. Die wirklichkeitsüberlegene Besserwisserei und Intoleranz dieser linken Umerzieher führt dazu, dass alternative Sichtweisen insbesondere auch auf das staatsmonopolistische Währungssystem und den Euro entweder redaktionell totgeschwiegen oder Kritiker als Verschwörungstheoretiker, Weltuntergangspropheten und Rechtspopulisten diffamiert werden. Mit allen Mitteln versuchen deutsche Leitmedien, einen rationalen Diskurs über das Geldsystem zu verhindern, der den eigenen politischen Heilsgewissheiten im Wege stehen könnte.

In der deutschen Vergangenheit waren es oftmals Flüchtlinge und Einwanderer, die mit neuen Ideen festgefahrene Denkstrukturen aufbrachen. So brachten im 16. Jahrhundert flämisch-niederländische Religionsflüchtlinge kapitalistische Innovationen in die deutschen Lande. 1558 errichteten sie in Hamburg nach Antwerpener Vorbild die erste deutsche Börse und erwarben binnen kürzester Zeit 34 der 42 größten Hamburger Handelshäuser. 1619 folgte dann die Gründung der Hamburger Bank mit einer 100 Prozent gedeckten Mark-Banco-Silberwährung, so dass dank dem Kapital und den Fertigkeiten dieser Einwanderer in der Hansestadt ein goldenes Zeitalter eingeleitet wurde.

Mit Ausbruch des Ersten Weltkriegs waren die Abkehr vom Kapitalismus und die Zuwendung hin zu den kollektivistisch-planwirtschaftlichen Ideen die Ursache für den kompletten ökonomischen und gesellschaftlichen Zusammenbruch in Hamburg und Deutschland. Nach dem Zweiten Weltkrieg führte dann glücklicherweise der von den liberalen Ideen der Österreichischen Schule der Ökonomie beeinflusste Ludwig Erhard zumindest in der BRD wieder marktwirtschaftliche Ordnungsprinzipien ein. So konnten Millionen deutscher Kriegsflüchtlinge aus den Ostgebieten wirtschaftlich integriert werden und zum sogenannten deutschen Wirtschaftswunder beitragen.

Dahingegen verfügen die Kriegsflüchtlinge des 21. Jahrhunderts weder über Kapital und Technologien, noch sind sie deutschsprachige Facharbeiter. Vielmehr entstammen sie einer Gesellschaft, die wie die 68er-Bewegung auf irrationalen und gegenaufklärerischen Ideen beruht. Bereits 1957 schrieb Ludwig von Mises in seinem Werk „Theorie und Geschichte“ über die arabisch-islamische Kultur: „Die Orientalen selbst nahmen an der Sklaverei, Knechtschaft, Unberührbarkeit, an Gebräuchen wie Witwenverbrennungen oder dem Verkrüppeln der Füße an Mädchen, barbarischen Bestrafungen, Massenelend, Unwissenheit, Aberglauben und der Missachtung der Hygiene keinen Anstoß. Unfähig, die Bedeutung von Freiheit und Individualismus zu begreifen, sind sie heute vom Programm des Kollektivismus verzaubert.“ Bereits jetzt hat die politische Linke mit ihrem erfolgreichen Marsch durch die Institutionen das Erfolgsmodell der Erhardschen Marktwirtschaft in einen durchbürokratisierten Sozialsozialismus (Roland Baader) transformiert, der es praktisch unmöglich macht, Millionen von Flüchtlingen in die Arbeitswelt zu integrieren. Die Merkelsche Flüchtlingspolitik beschleunigt somit die bereits eingetretene Kapital- und Wohlstandserosion innerhalb der EU, und gleichzeitig machen Millionen vom Kollektivismus beseelte Flüchtlinge eine zukünftige Rückkehr zu rechtsstaatlichen und marktwirtschaftlichen Prinzipien immer unwahrscheinlicher.

Die Geschichte zeigt, dass mit fortschreitendem Niedergang eines Gesellschaftssystems auch die Behauptungsversuche des herrschenden Establishments immer skrupelloser werden. Beschränkten sich die deutschen Leitmedien und die Regierungsparteien in den ersten Jahren nach Ausbruch der Finanzkrise noch auf persönliche Diffamierungen von Geldsystemkritikern, wird mittlerweile auf Vertreter konträrer Meinungen insbesondere in den sozialen Netzwerken immer öfter die Staatsanwaltschaft angesetzt. Staatlich subventionierte Organisationen aus der linken Szene fühlen sich von den Berliner Hetzkampagnen so bestärkt, dass in den letzten Monaten auf EU- und Euro-Kritiker, darunter auch ehemalige Referenten der Hamburger Mark-Banco-Anlegertagungen, wiederholt Anschläge verübt und Morddrohungen ausgesprochen wurden.

Vor diesem Hintergrund beginnen immer mehr weitsichtige Deutsche, sich außerhalb der EU ein zweites Standbein aufzubauen. In Kanada, Panama, Paraguay und auf den Philippinen haben sich in den letzten Jahren deutschsprachige Communities gebildet, die an den Beginn der Hansebewegung niederdeutscher Kaufleute vor 1.000 Jahren erinnern. Die 7. Hamburger Mark-Banco-Tagung bietet dieses Jahr daher insbesondere die Möglichkeit, sich neben bankenunabhängigen Vermögenssicherungsstrategien auch über Auswanderungsalternativen außerhalb der EU zu informieren und internationale Kontakte zu schließen.

Ich freue mich auf ein Wiedersehen am Samstag, dem 28. Mai 2016, auf dem Dachgeschoss des Internationalen Maritimen Museums in der Hamburger Hafencity. Welcher Ort könnte passender sein als das „Tor zur Welt“, um den Blick auf neue Horizonte zu richten?

Der Autor Steffen Krug, Gründer des Instituts für Austrian Asset Management, veranstaltet am 28. Mai 2016 die 7. Hamburger Mark-Banco-Anlegertagung im Internationalen Maritimen Museum in der Hafencity, in deren Rahmen die Roland-Baader-Auszeichnung 2016 an Robert Nef verliehen wird. Die Laudatio hält eigentümlich-frei-Herausgeber Andre F. Lichtschlag (Gewinner der Roland-Baader-Auszeichnung 2015). Detaillierte Infos unter www.ifaam.de.

Keine Kommentare:

Kommentar veröffentlichen

Haben Sie Fragen oder Anregungen? Schreiben Sie uns!

Name

E-Mail *

Nachricht *